PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 204aa    MW: 23248.9 Da    PI: 6.8479
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009610genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.2e-30130188159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYG+K+vk++++pr+YY+C+s gC+vkk+ver+ +d ++v++tYeg Hnhe
  DCAR_009610 130 LDDGYKWRKYGKKMVKNNPNPRNYYKCSSVGCKVKKRVERDLKDSSFVITTYEGIHNHE 188
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.4E-32118190IPR003657WRKY domain
SuperFamilySSF1182901.44E-27123190IPR003657WRKY domain
PROSITE profilePS5081130.641125190IPR003657WRKY domain
SMARTSM007747.0E-35130189IPR003657WRKY domain
PfamPF031061.2E-23131188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MSTSLAPPII QPPASNPNPT FTNSLTYTIC DDLGFEFLDY LSFGDHHQLE DHDYTCNFIT  60
SAHVAQAPLI LQENNTSAES SLNSNHDDMD IGHHVLPTNK CSKRMKRSDK SDENGGSRIA  120
FRIKTELETL DDGYKWRKYG KKMVKNNPNP RNYYKCSSVG CKVKKRVERD LKDSSFVITT  180
YEGIHNHETP HAFVYYNTQM QYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-25120190777Probable WRKY transcription factor 4
2lex_A3e-25120190777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ93WU98e-37WRK51_ARATH; Probable WRKY transcription factor 51
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21242462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.15e-38WRKY DNA-binding protein 51